General Information

  • ID:  hor007188
  • Uniprot ID:  Q6H8S9??28-192)
  • Protein name:  Erythropoietin
  • Gene name:  Insl6
  • Organism:  Nannospalax galili
  • Family:  EPO/TPO family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Spalacidae; Spalacinae (blind mole-rats); Nannospalax (Mediterranean blind mole-rats); Nannospalax galili (Northern Israeli blind subterran
  • GO MF:  GO:0009986 cell surface; GO:0005615 extracellular space
  • GO BP:  GO:0005179 hormone activity; GO:0005128 erythropoietin receptor binding; GO:0005125 cytokine activity; GO:0030295 protein kinase activator activity
  • GO CC:  GO:1902251 negative regulation of erythrocyte apoptotic process; GO:1902219 negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress; GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0008284 positive regulation of cell population proliferation; GO:0038162 erythropoietin-mediated signaling pathway; GO:0045893 positive regulation of DNA-templated transcription; GO:0046579 positive regulation of Ras protein signal transduction; GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein; GO:0001666 response to hypoxia; GO:0071474 cellular hyperosmotic response; GO:0033028 myeloid cell apoptotic process; GO:0010523 negative regulation of calcium ion transport into cytosol; GO:0043249 erythrocyte maturation; GO:0007566 embryo implantation; GO:0042541 hemoglobin biosynthetic process

Sequence Information

  • Sequence:  PPRLICDSRVLERYILEAKEAENITMGCAEGPRFNENFTVPDTKVNFYAWKTMGVEEQAVEVWQGLSLLFEAILRAQAVLANSSQPSEMLQLHVDKAISGLRSLTSLLRALGAQKEAISPPDTTQVIPLRRFTVDTFCKLFRIYSNFLRGKLKLYTGEACRRGDR
  • Length:  165
  • Propeptide:  MGVPDCLALPLLVTFLLLSLGLPVLGAPPRLICDSRVLERYILEAKEAENITMGCAEGPRFNENFTVPDTKVNFYAWKTMGVEEQAVEVWQGLSLLFEAILRAQAVLANSSQPSEMLQLHVDKAISGLRSLTSLLRALGAQKEAISPPDTTQVIPLRRFTVDTFCKLFRIYSNFLRGKLKLYTGEACRRGDR
  • Signal peptide:  MKTVQFCFLFCCWKAICC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA